PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000344978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 214aa    MW: 24399.1 Da    PI: 8.2352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000344978genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-173582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
    MDP0000344978 35 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 82
                     79********************************************97 PP

2Myb_DNA-binding55.61.3e-1788131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
    MDP0000344978  88 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 131
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-232885IPR009057Homeodomain-like
PROSITE profilePS5129415.9193082IPR017930Myb domain
SuperFamilySSF466891.5E-3033129IPR009057Homeodomain-like
SMARTSM007178.1E-133484IPR001005SANT/Myb domain
PfamPF002491.5E-163582IPR001005SANT/Myb domain
CDDcd001673.92E-103782No hitNo description
PROSITE profilePS5129425.85983137IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2586137IPR009057Homeodomain-like
SMARTSM007171.8E-1587135IPR001005SANT/Myb domain
PfamPF002491.7E-1688131IPR001005SANT/Myb domain
CDDcd001673.83E-1292131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
SPSLSLSLSP ETHKHKNKMD KKPCNSSSQD VEVRKGPWTM EEDLILINYI ANHGEGVWNS  60
LAKSAGLKRT GKSCRLRWLN YLRPDVRRGN ITPEEQLLIM ELHAKWGNRW SKIAKHLPGR  120
TDNEIKNYWR TRIQKHIKQA ENITPGQSSE VNDQASTSQV SISNTVDTMD ISHSAPTYQA  180
NMDAYPPPLP ADQSNESYWS MEDLWSLQLL NGEX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26161376128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341440.11e-145PREDICTED: myb-related protein 305-like
SwissprotP813911e-102MYB05_ANTMA; Myb-related protein 305
TrEMBLM5XIW31e-126M5XIW3_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g01090.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.12e-91myb domain protein 24